Search Tagsfor gym

letsgetlostonanadventure

letsgetlostonanadventure

@letsgetlostonanadventure


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e15/16908060_1250544298396701_2699356936599502848_n.jpg

Comment from letsgetlostonanadventure:


Not sure what is more exciting. The thrill of walking down 5 floors of stairs, or forgetting that you had 4 floors left 🤣 sillythrillalwayshappysmilesmirkfloorsstairsgymfitfitness

2 Seconds ago
kazakova.taganrog

Оля 🎯 ТРЕНИРОВКИ 💪💯Таганрог

@kazakova.taganrog


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/16789959_292112901204219_1197013222255755264_n.jpg

Comment from Оля 🎯 ТРЕНИРОВКИ 💪💯Таганрог:


Лучшие продукты для правильного питания Лучшие белковые продукты 🔸 Мясо - любое нежирное Показать полностью… 🔸 Птица - нежирное мясо 🔸 Рыба - в том числе жирная 🔸 Морепродукты - кальмар, креветки... 🔸 Яйца 🔸 Творог - маложирный 🔸 Сыр - маложирный 🔸 Бобовые - фасоль, бобы, горох и др. Лучшие углеводные продукты - каши из цельных зерновых культур: 🔸 Гречневая 🔸 Овсяная 🔸 Ячменная (перловка) 🔸 Киноа 🔸 Пшеничная 🔸Булгур 🔸 Рисовая (бурый, дикий) 🔸 Кукурузная 🔸 Макароны из твердых сортов пшеницы 🔸 Лапша 🔸 Овощи - с небольшим содержанием клетчатки Лучшие продукты - источники жиров: 🔸 Рыба 🔸 Рыбий жир 🔸 Орехи, семена и косточки 🔸 Авокадо Лучшие продукты - источники витаминов: 🔸 Киви 🔸 Яблоки 🔸 Абрикосы 🔸 Груши 🔸 Финики (но помните, что они также содержат много простых углеводов) 🔸 Гранаты 🔸 Авокадо 🔸 Цитрусовые 🔸 Лук 🔸 Чеснок 🔸 Зелень healthy healthychoices fitness fitnessaddict fitnessmodel fitnessmotivation fitnessjourney fitnessfreak instagramanet instatag gym gymlife gymrat фитнес фитнестаганрогфитнесклуб фитнесмодель спортзал здоровье trx trxmoscow здоровоепитание здоровыйобразжизни тренер тренировка видеотренировка функциональныйтренинг

3 Seconds ago
exotic.girl_

Goal 30k Press Here❤️↗️

@exotic.girl_


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/16906964_264259744016166_95306784587120640_n.jpg

Comment from Goal 30k Press Here❤️↗️:


Follow ; @raunchybaddies 💦 _ model fitspo fitness fitfam fitnessmotivation fitgirl stayfit beautiful picoftheday modelo top linda loirinha blonde fitness gym photo love look beauty like bomdia boanoite selfie sexy biquini instagood instagram _ • @nickiminaj @selenagomez @beyonce @estefany_hot_ _ Promo By ; @miiss.biitch 🍒

3 Seconds ago
completenutritionodessa01

Complete nutrition odessa

@completenutritionodessa01


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/16789062_1387443861316866_1450003103980978176_n.jpg

Comment from Complete nutrition odessa:


Annex + milk + a few chocolate chips = the perfect post workout reward. Take it from @croatiangirl_fitness who swears by Annex! Athletes love it! Did you know that Elite Gold Annex is triple-cold filtered to retain the natural protein structure and integrity? Thanks Nikki for sharing your photo! completenutrition protein workout fit fitnesslifestyle fitfam gym motivation competitionprep

4 Seconds ago
cesartideifilho

Cesar Tidei Filho

@cesartideifilho


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/c0.26.720.720/16790356_1032379296893336_6307068635617689600_n.jpg

Comment from Cesar Tidei Filho:


😎🙄😆 Es encantadora que sabe qué hacer, todo lo justo, estoy enamorado de ella! Rsssss coach MUSCULAÇÃO ACADEMIA ME MENSFITNESS BODYBUILDING TREINO MONSTRO OGRO RUMOAOSINISTRO MUTANTE SUPLEMENTO OUTRASPARADAS SUMMER TRAINING GYM FIT BODY STYLE STILO WHEY CARDIO LOVE STRONG CAVEIRA muscle ficamagro emagrecer proteína consultoria

6 Seconds ago
beauty_on_planet

Beauty On Planet

@beauty_on_planet


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/16788836_1438337469554581_5324655116458917888_n.jpg

Comment from Beauty On Planet:


🔝 funny baby webstagram followback @top.tags foodporn tweegram hot makeup instasize ootd my iphonesia black instapic instacool pink blue yummy instafollow tags instalove igdaily healthy likes wcw model red awesome gym sweet

7 Seconds ago
muscool2015

muscool2015

@muscool2015


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e15/c139.0.362.362/16583834_1200693786705126_6235679020663439360_n.jpg

Comment from muscool2015:


Вот так нужно отмечать 23 февраля, как @valeriya_grinkova & @nechitaev_andrey 💪🏼🌰 Тренер: @rgavchick_fit 🔥 muscool muscooltsk fitness fitnessmotivation sport body bodybuilding aesthetic aestetics workout workhard tomsk tsk instatomsk instasport fitnessmodel cardio gym gymnastics training mensphysique msk bikini

9 Seconds ago
eastmotionfitness

EM Fitness

@eastmotionfitness


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/16906391_234858530256903_6438116377105530880_n.jpg

Comment from EM Fitness:


My grandmama can squat more than you. . . . . . . fit fitspo fitness fitspiration fitfam fitnessfreak fitnessaddict fitnessapparel gym gymtime gymrat fitnessmotivation progress getstrong igdaily ignation igFitnesseastMotionFitnessweightlifting flex fitstagram motivation

9 Seconds ago
cabirdurdu

Allah'ın Dediği Olur.

@cabirdurdu


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/c0.12.1080.1080/16908631_406044643075933_5147315753598320640_n.jpg

Comment from Allah'ın Dediği Olur.:


antalya konyaalti beach deniz kum manzara view likeasummer 23c° instagram gym turkey

9 Seconds ago
scottygreenlaw

Scotty Greenlaw

@scottygreenlaw


https://instagramstatic-a.akamaihd.net/null.jpg

Comment from Scotty Greenlaw:


10 Seconds ago
rauls.rated.fit

Raul Hernandez

@rauls.rated.fit


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/16788411_271860673242325_3653450863042625536_n.jpg

Comment from Raul Hernandez:


How am I looking ?😂a scale 1-10 teamseid jeffseid motivation fitnessjourney fitfam cardio workout fitness workingout gymlife fitspo fit gym fitnessmodel health beast fitness motivation shredding beastmode muscle ripped fitnessaddict gymrat goku bodybuilding fitnesslifestyle fitspiration igfitness aestheitcs

11 Seconds ago
kiddsuave

Kidd Suave

@kiddsuave


https://instagramstatic-a.akamaihd.net/null.jpg

Comment from Kidd Suave:


11 Seconds ago
joplin_love_life

Dallas Musician.

@joplin_love_life


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/c0.134.1080.1080/16789600_1763893767263199_5000106561276739584_n.jpg

Comment from Dallas Musician.:


Running makes me happy and relax. running workout gym fitness fit loseweịght

11 Seconds ago
samantha_jo_kerber

Samantha Jo💙

@samantha_jo_kerber


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/16908626_1201467896569167_8257329764797251584_n.jpg

Comment from Samantha Jo💙:


Heck yes!!😂💪😻 fitness fit fitnessmotivation fit fitfam fitmom fitmoms workout workoutmotivation workouts healthy gym gym💪 gymlife gains💪 gymrats thursday goodnight

11 Seconds ago
chiseledphysiques_

Chisled Physiques

@chiseledphysiques_


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/16908231_259431297815347_8044405206319890432_n.jpg

Comment from Chisled Physiques:


A cup of medium-hot water with lemon juice first thing in the morning purifies the liver. This morning ritual should be a staple for bodybuilders who intake supplements that are hard on the liver. It can also help ease joint pain and inflammation by cleansing the system from impurities and releasing the acidity and uric the body’s digestive and detox systems, lemon is a natural energizing remedy. acid from the joints. lemon-water-for-bodybuildingWhen it comes to boostingDrinking the juice encourages our body to detox naturally. It helps the kidneys and the liver wash out toxins, and gives your body the essential nutrients it needs for radiant skin. Lemons contain calcium, magnesium, vitamin C, bioflavonoids, pectin, citric acid, and ascorbic acid. Ascorbic acid is a natural antioxidant that plays an important role in the prevention of carcinogenesis, cardiovascular problems, and many chronic diseases. Drinking lemon water helps the liver produce enzymes for the body to stay at an alkaline condition. Having your insides work to best of there abilities is key for metabolism and getting most out the nutrients you put in your body!!healthychoiceshealthylifehealthylifestylehealthsciencegainsmusclebuildingpersonaltrainerweightliftingweightsvitaminsmusclesmusclebodybuildinglifestylebodybuildingbodybuilderfitnessfitlifefitlifestylefitgoalsgymgymlifegymratfatlosslifestyleexercise

13 Seconds ago
ifbb_lady_physique

Victoria Flores

@ifbb_lady_physique


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e15/16908279_1831768250373926_6530949754451394560_n.jpg

Comment from Victoria Flores:


I love this movement!! I get the best hamstring and glute stretch. My lower back also gets a break from all the stain on leg day 👌🏼 detail detail detail fitfam hamstrings legday fitspo gym aesthetics paleodiet fitfood fit fitness womensphysique muscle bodybuilding healthcoach ifbb npc 😘

13 Seconds ago
matthew__mcclure

Matthew McClure

@matthew__mcclure


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/c41.0.997.997/16906807_248659585592586_3996090030928953344_n.jpg

Comment from Matthew McClure:


Got my reUP from @bpi_sports for the month.. Salted Caramel ISOHD Protein, Apple Pear BEST BCAA, and B4 Thermogenic Fat Burner... can't wait to ROCK all these goodies 🤘💪 get all these and many more at www.bpisports.com and use my discount code MMCCLURE for 20% off on your entire order 🤑 thankfulthursday bpiathlete teambpi sponsoredathlete ______________________________________________________ Supplements - BPI SPORTS 🔷www.bpisports.com ______________________________________________________ bpisports teambpi rocitfit sponsoredathlete bodybuilding fitness fitfam fitspo fitnessmodel igfitness igfit motivation inspiration instadaily instagood instalike picoftheday iifym gym gymlife mensphysique thankful blessed happy followme follow beard

14 Seconds ago
onemilindasmith

Milinda A.A. Smith

@onemilindasmith


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/c0.134.1080.1080/16584972_698461410322296_8912834257697636352_n.jpg

Comment from Milinda A.A. Smith:


🎉🎉🎉BIRTHDAY GIRL!!!🎊🎊 I'm not sure why our eyes wouldn't open😩🤣 Tell her Happy Birthdayy!!

24 Seconds ago
lmm_willpow3r

Leah M

@lmm_willpow3r


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/c0.134.1080.1080/16908894_1880960312138353_669068545081999360_n.jpg

Comment from Leah M:


3 mile jog paired with 6 miles on the bike. Phew 🤗💦

31 Seconds ago
djsamwithers

DJ MALEMODEL

@djsamwithers


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/16788859_161723201001890_7488691710151622656_n.jpg

Comment from DJ MALEMODEL:


45 Seconds ago