Search Tagsfor bodybuilding

simonsflam

Simon Lam

@simonsflam


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/21041753_550472305320289_2995303268743118848_n.jpg

Comment from Simon Lam:


Body of a god, shame it's Buddha ❌ Team no abs 👊 summersuntraveltravelgramwanderlustholidayvacationinstatraveladventurebodybuildingmotivationgymgymsharkgymratfitfitnessfitfamgymlifefitspo

3 Seconds ago
claudiacoco007

ClaudiaCoco IfbbBikini Atlhete

@claudiacoco007


https://scontent.cdninstagram.com/t51.2885-15/e35/p280x280/20905004_1994734777475683_5539583552057769984_n.jpg

Comment from ClaudiaCoco IfbbBikini Atlhete:


Pink💖 girl fitnessmodel bikinimodel bikini summer bodybuilding love passion body makeup girls brunette fit muscle italy sicily picofday tagsforlikes follow4follow followback commentbacklikeback goout shopping

3 Seconds ago
karolfit27

Karolfit

@karolfit27


https://scontent.cdninstagram.com/t51.2885-15/e35/p280x280/20987039_513211699019720_6986030478952235008_n.jpg

Comment from Karolfit:


Así ... tal cual ✌🏼🤗buenos días. bodybuilding beauty bis bodyfitness fitnessmotivation squats sexy hot booty🍑 sentadillas sensual inshape peruviangirl gymlifehealthy vidasana glutes fitgirl legs latina erotik wonderwoman femme

4 Seconds ago
zblack1209

Zachary Black

@zblack1209


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e15/20987133_600273430362832_2388447724375638016_n.jpg

Comment from Zachary Black:


Little clip from yesterday 🤙🏼 The 130's felt like the 150's 😂 I'll sound like a broken record these next few weeks so I'll apologize in advance - right about now is when I need to mentally prepare for the strength to decrease, just have to stay the course n stuck this out! I've always given up on a cut, refuse to quit this time 😈 - fitdad fitfam instafit iifym macros fitness motivation inspiration determination dedication athlete halfnatty boutthatlife timetogrind freakofnature power bodybuilding stayhumble neversettle neverquit riseabove gymshark dumbbells gym fitlife aesthetic ogus753 transformationtuesday @teamhousestrong @ogus753

4 Seconds ago
akim_mensphysique

Akim IFBB Master Mensphysique

@akim_mensphysique


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/20987569_1981528115207730_3565332573808754688_n.jpg

Comment from Akim IFBB Master Mensphysique:


Physique update, prise de masse oblige les abdos sont visibles à la loupe 😬 par contre de supers sensations aux entraînements encore 3 mois pour se remplir au mieux 🚧notamment sur mon point faible les pecs et revenir sur scène avec la meilleure shape possible... bon d'ici là le réveille est régler à 03h du matin pour demain😞 bonne soirée les amis 🌙 shape shapes mensphysique bodybuilding fit fitness fitnessmotivation fitboy fitnesslifestyle fitfam fitfrenchies muscu musculation musculacao muscular bikini diet food tatoo dubaifitness instafit follow4follow teamshape aarmy

5 Seconds ago
matt_brown_be_fit

Matt Brown

@matt_brown_be_fit


https://scontent.cdninstagram.com/t51.2885-15/e35/p280x280/20986842_1462866703800402_482306822837895168_n.jpg

Comment from Matt Brown:


Margarita bcaa's 🍹💪 gym bodybuilding fitfreak nutrition bcaa supplements npc ifbb margarita

6 Seconds ago
arielmelos

Ariel Melo

@arielmelos


https://scontent.cdninstagram.com/t51.2885-15/e35/p280x280/20905841_127557777868679_7066333701528879104_n.jpg

Comment from Ariel Melo:


Tropkillaz - Freaks 🎶 ________________________ goodvibrations wolf hairymen hairystyle hairchest hair bear bigger lumberjacks lenhador pelos fitness bodybuilder bodybuilding click homaodaporra sunset tattoo smile home pool

6 Seconds ago
shegavemeburpees

28 | UK | 104lbs lost

@shegavemeburpees


https://scontent.cdninstagram.com/t51.2885-15/e35/p280x280/20987418_1495803423816742_57763281451876352_n.jpg

Comment from 28 | UK | 104lbs lost:


: "hello triceps my old friend, I've come to train with you again." . . . Starting to see some improved results with definition now that I've thrown some more calisthenics into my regime. . . . workout exercise weighttraining weightlossjourney weightloss inspiration motivation fitnessmotivation fitness weightlossmotivation dedication followback gains beastmode beast fitspo fitfam fitsporation muscle weightlifting instafit dedication positive bodybuilding bodypositive guyswithtattoos selfie shauntfitness insanityworkout triceps

7 Seconds ago
next_europa

⚡️YEYE DIAZ⚡️ NEXT FITNESS

@next_europa


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e15/20968682_111827772829383_5485307423272992768_n.jpg

Comment from ⚡️YEYE DIAZ⚡️ NEXT FITNESS:


☀️👙ELIMINA IMPUREZAS Y BAJA ESOS KILOS DE MÁS EN SOLO 30 DIAS!⚡️💪🏻 - 👉🏻PASO 1👉🏻DESINTOXICA TU ORGANISMO EN 4 DIAS ✅Elimina Toxinas ✅Regula Transito Intestinal ✅Desinflama Zona Abdominal ✅Rapida Activación del Metabolismo - 👉🏻PASO2👉🏻 CON NEXT PIERDE PESO EN 30 DIAS 👈🏻 ✅Elimina la ansiedad ✅Quema grasa localizada ✅Reduce medidas - LLEVA ESTE PACK POR SOLO 85€ ☀️👙👑 - 📦🍃PEDIDOS📦🍃 COL🇨🇴+57 3142339329 ESP🇪🇸‭+44 7389 161020‬ Shopline 🌐⬇️⬇️⬇️ WWW.ONDAFITNESS.COM bajadepeso detoxtea detox4d detox pierdepeso cleanyourbody nextfitness health fitness fit appbreeze bodytransformation workout bodybuilding cardio gym train training healthy instahealth healthychoices active strong motivation yeyediaz madrid Colombia

8 Seconds ago
jas_has_aesthetics

Jasam Hancock Ahmed

@jas_has_aesthetics


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e15/20905568_1448251808562176_3441435330098495488_n.jpg

Comment from Jasam Hancock Ahmed:


Welcome to my world 💪. Shredded city. Am I allowed to be proud of being shredded,? Yes, I did this, no coach, no job. Me, all me. Apparently I am a bum, you will never ever ever have the same drive as me. Unlucky m8. bodybuilding protein gym gymlife cleaneating lifting gainz gains asthetics instafitness veins lifting myprotein gymjunkie weightlifting ripped muscles shoulders fitfam fitness cutting nutrition gymrat fitnessmotivation fitnessmodel vascular vascularity myproteinuk bodybuildingmotivation shredded followme

9 Seconds ago
tenaciousg

George Corry

@tenaciousg


https://scontent.cdninstagram.com/t51.2885-15/e35/p280x280/20905744_110059529690498_6886778951587332096_n.jpg

Comment from George Corry:


First training session back from my weekend away. Shoulders, biceps and tredmill walk. Did lots of tempo work on both shoulders and biceps. Mainly to aid in shoulder recovery and get a good pump from shoulders and a great pump on biceps. High incline walking on tredmill for 20 minutes. Back at crossfit tomorrow! gym gymmotivation workout exercise CrossFit CrossFitGames motivation inspiration shoulders arms biceps abs muscle physique fit fitspo fitspiration fitstagram fitness fitnessmodel fitnessmotivation fitnessjourney getfit healthy bodybuilding instafitness igfitness

10 Seconds ago
totalbod

Total Body Sports Nutrition

@totalbod


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/21041257_112403529429036_6090201228443123712_n.jpg

Comment from Total Body Sports Nutrition:


All right TB fitfam this is the shipment I've been waiting for! @yellowstonenutra is officially in. Let me tell you these products rock. High quality supplements that taste amazing. I have 100% whey in Oreo, Chocolate Quick and Froot Hoops. This protein not only mixes up perfectly every time but also taste spot on with flavoring. Not to mention is easily digestible and is backed with GMP stamps of approval. XM25 is the heaviest hitting pre workout I have ever tried personally. This pre is my favorite product due to the intense focus, pump and energy it delivers. Step up your workouts and try XM25 I promise it won't disappoint! Amino Blast with it's amazing taste and long lasting endurance. It provides a 2:1:1 ratio of BCAA's. These are essential for fueling your long lasting workouts! Stop by Total Body and pick some up because they won't last long I promise! supplements fitness fitfam instafit instagood npc ifbb classicphysique bodybuilding aesthetics nutrition progress goals gains workout workhard killit gymlife muscle train totalbod totalbody teamtb

10 Seconds ago
laurabardsley

Fitness Coach 🔹 PCA Bikini

@laurabardsley


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/20905586_120932531890748_5376783224724783104_n.jpg

Comment from Fitness Coach 🔹 PCA Bikini:


💙GENUINE HAPPINESS💙 I get asked a lot about whether I found it mentally tough gaining weight and watching my body changing shape and size during recovery from anorexia. Short answer - YES. Yes it was one massive mental struggle. 🔸🔸 I wish I could offer a simple way to overcome that dread and fear that occurs when you see the scale going up, your body changing shape or your clothes getting tighter but there really isn't a straight forward way to overcome these inevitable fears. 🔸🔸 I can say this though - the body shape I had and the weight I was when I was ill never brought me genuine happiness. It brought me short term satisfaction because at the time my happiness was defined by how small I could get, but the reality was I was unhappy all of the bloody time. It caused me health problems, it put strain on relationships with family and friends, it made me see the world in a negative way, it made me miss out on life experiences and it made me hate the reflection I saw in the mirror everyday. 🔸🔸 Gaining weight gave me my life back and it's allowed me to live a life where I can be happy, spontaneous and accepting of myself. It's allowed me to create happy memories with friends and family and do cool stuff that I would have otherwise avoided. It's allowed me to not give a fuk about what others think of me or my body. 🔸🔸 So while I can't supply a simple step by step formula to accepting weight gain, I can say that having been ill and having recovered, I would hands down pick true happiness and LIFE over a low weight, skinny legs and flat stomach. Anoreixa makes you believe that your tiny clothes and low weight will bring long term happiness when in reality it's a downward spiral of self loathing. So while gaining weight is scary, remember that weight gain is a step towards genuine happiness. Be honest with yourself and think what it is that will ACTUALLY bring you GENUINE fulfilment and happiness. I can guarantee that 'being skinny' won't be up there. 🔸🔸 It's going to be a struggle, I promise, but I can also promise that happiness is worth the struggle. Keep fighting ✌🏼💙

14 Seconds ago
madsjacobsn

Mads Jacobsen

@madsjacobsn


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e35/20968497_185560751985779_7943530245741608960_n.jpg

Comment from Mads Jacobsen:


Throwback 🤓

14 Seconds ago
p.tcorner

P.T CORNER⚡️

@p.tcorner


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e15/20969218_332050703886314_3324019161973129216_n.jpg

Comment from P.T CORNER⚡️:


A great trainer always seeks for new techniques and ideas to help his clients achieve their goal with joy and fun unlike boring pain......the "100" squat challenge done by @joelle_bejjani 🍑💪🏼 Rules:10 cards Squat to pick up the first Squat to put it on the next one then squat twice to pick them up again In the last card you will be squating 19 times for a total of 💯 TIME:less than 3 minutes personaltrainer personaltraining bodybuildingmotivation bodybuilding fitnessaddict fitnessmodel fitnessmotivation fitnessfreak gym muscle tattoo zyzz beastmode kettlebell gymlife gymshark gymmotivation gymtime shredded muscles squats booty🍑 bootyfordays bööty

16 Seconds ago
diivictor

Diogo Victor 🇧🇷

@diivictor


https://scontent.cdninstagram.com/t51.2885-15/e35/p280x280/21041254_370582290027996_2265609911658348544_n.jpg

Comment from Diogo Victor 🇧🇷:


Vamos que vamos atingir a meta de treino no Crossfit 💪🏻💪🏻 crossfit @cangaco

17 Seconds ago
fitz.mitch

Mitch Lohr

@fitz.mitch


https://scontent.cdninstagram.com/t51.2885-15/e15/p280x280/20986729_1994021910832082_7634899101351411712_n.jpg

Comment from Mitch Lohr:


Stretch to the top - squeeze at the bottom - repeat 💪🏼 osg maxeffortmuscle 4amcrew oldschool bodybuilding flex work

19 Seconds ago
jake_ukbffbodybuilder

jacob hammond

@jake_ukbffbodybuilder


https://scontent.cdninstagram.com/t51.2885-15/e15/p280x280/20968455_1404659746253752_1967080908305465344_n.jpg

Comment from jacob hammond:


Making sure no one is working harder than me, what ever happens on Sunday if gave it my best shot with the things iv had going on.. love to train.... bodybuilder tattoomuscle gym gettingitdone grind ripped bodyfat gains fitness bodybuilding deadlifts lovetotrain gettinginshape 5daysout

27 Seconds ago
trandenny

Denny 🍍🏋️

@trandenny


https://scontent.cdninstagram.com/t51.2885-15/s280x280/e15/21041681_1341787995947656_8012921317923749888_n.jpg

Comment from Denny 🍍🏋️:


440lb for a small PR depth might be questionable but the camera angle isn't helping either. 10 ish weeks to clean it up a bit. oh and almost died reracking the weight 👏🏻

1 Minutes ago
newfit_world

fit_world

@newfit_world


https://scontent.cdninstagram.com/t51.2885-15/e35/p280x280/21041564_1881907665158978_6801565340145811456_n.jpg

Comment from fit_world:


Who is ready ?.............. . . . . . . . . . . . . . . . fitnessjourney fitnessaddict fitnessgoals fitnesslife fitnessgirls femalebodybuilding fitness fitnessphysique fitnesswomen gymgirl hot sexy fitmum fitnessmodel fitwoman fitnessbikini curvygirl sexywoman fitnessmotivation sexymodel squats nofilter hotgirls fitgirls gym bikinigirls fitchicks tbt nofilter selfie bodybuilding

2 Minutes ago